MHC I ligand prediction package with competitive accuracy and a fast and documented implementation.
Important
Version 2.2.0 is the first release to use PyTorch as its neural network backend, replacing TensorFlow/Keras used in previous versions. It loads the same published weights and produces equivalent predictions, so existing workflows should continue to work with no changes.
Key changes in 2.2.0:
- Backend: TensorFlow/Keras replaced by PyTorch (>= 2.0)
- Python: Requires Python 3.10+ (previously 3.9+)
- Dependencies:
pandas >= 2.0is now required;tensorflowandkerasare no longer needed - Hardware: Automatic GPU detection; Apple Silicon (MPS) is now supported
If you are upgrading from 2.1.x, simply pip install --upgrade mhcflurry. The published pre-trained models are unchanged and will be loaded and converted automatically.
MHCflurry implements class I peptide/MHC binding affinity prediction. The current version provides pan-MHC I predictors supporting any MHC allele of known sequence. MHCflurry runs on Python 3.10+ using the PyTorch neural network library. It exposes command-line and Python library interfaces.
MHCflurry also includes two experimental predictors, an "antigen processing" predictor that attempts to model MHC allele-independent effects such as proteosomal cleavage and a "presentation" predictor that integrates processing predictions with binding affinity predictions to give a composite "presentation score." Both models are trained on mass spec-identified MHC ligands.
If you find MHCflurry useful in your research please cite:
T. O'Donnell, A. Rubinsteyn, U. Laserson. "MHCflurry 2.0: Improved pan-allele prediction of MHC I-presented peptides by incorporating antigen processing," Cell Systems, 2020. https://doi.org/10.1016/j.cels.2020.06.010
T. O'Donnell, A. Rubinsteyn, M. Bonsack, A. B. Riemer, U. Laserson, and J. Hammerbacher, "MHCflurry: Open-Source Class I MHC Binding Affinity Prediction," Cell Systems, 2018. https://doi.org/10.1016/j.cels.2018.05.014
Please file an issue if you have questions or encounter problems.
Have a bugfix or other contribution? We would love your help. See our contributing guidelines.
You can generate MHCflurry predictions without any setup by running our Google colaboratory notebook.
Install the package:
$ pip install mhcflurry
Download our datasets and trained models:
$ mhcflurry-downloads fetch
You can now generate predictions:
$ mhcflurry-predict \
--alleles HLA-A0201 HLA-A0301 \
--peptides SIINFEKL SIINFEKD SIINFEKQ \
--out /tmp/predictions.csv
Wrote: /tmp/predictions.csv
Or scan protein sequences for potential epitopes:
$ mhcflurry-predict-scan \
--sequences MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS \
--alleles HLA-A*02:01 \
--out /tmp/predictions.csv
Wrote: /tmp/predictions.csv
See the documentation for more details.
You can also try the latest (GitHub master) version of MHCflurry using the Docker image hosted on Dockerhub by running:
$ docker run -p 9999:9999 --rm openvax/mhcflurry:latest
This will start a jupyter notebook server in an
environment that has MHCflurry installed. Go to http://localhost:9999 in a
browser to use it.
To build the Docker image yourself, from a checkout run:
$ docker build -t mhcflurry:latest .
$ docker run -p 9999:9999 --rm mhcflurry:latest
Sequence logos for the binding motifs learned by MHCflurry BA are available here.
Some users have reported HTTP connection issues when using mhcflurry-downloads fetch. As a workaround, you can download the data manually (e.g. using wget) and then use mhcflurry-downloads just to copy the data to the right place.
To do this, first get the URL(s) of the downloads you need using mhcflurry-downloads url:
$ mhcflurry-downloads url models_class1_presentation
https://github.com/openvax/mhcflurry/releases/download/1.6.0/models_class1_presentation.20200205.tar.bz2```
Then make a directory and download the needed files to this directory:
$ mkdir downloads
$ wget --directory-prefix downloads https://github.com/openvax/mhcflurry/releases/download/1.6.0/models_class1_presentation.20200205.tar.bz2```
HTTP request sent, awaiting response... 200 OK
Length: 72616448 (69M) [application/octet-stream]
Saving to: 'downloads/models_class1_presentation.20200205.tar.bz2'
Now call mhcflurry-downloads fetch with the --already-downloaded-dir option to indicate that the downloads should be retrived from the specified directory:
$ mhcflurry-downloads fetch models_class1_presentation --already-downloaded-dir downloads